论文信息 - Frog Corticotropin‐Releasing Hormone (CRH): Isolation, Molecular Cloning, and Biological Activity

Frog Corticotropin‐Releasing Hormone (CRH): Isolation, Molecular Cloning, and Biological Activity

Abstract: Corticotropin‐releasing hormone (CRH) was isolated from the brain of the European green frog, Rana esculenta, by combining HPLC purification with radioimmunoassay (RIA) detection. The amino acid sequence SEEPPISLDLTFHLLREVLEMARAEQIAQQAHSNRKLMDII was identical with the sequence of bullfrog (R. catesbeiana) CRH that was deduced from a cDNA encoding the CRH precursor. Synthetic frog CRH enhanced the release of thyroid‐stimulating hormone (TSH) from dispersed bullfrog pituitary cells in a concentration‐dependent manner. The TSH‐releasing activity of a bullfrog hypothalamic extract was decreased by approximately 45% in the presence of the CRH receptor antagonist, α‐helical CRH9‐41, suggesting that CRH is one of the main TSH‐releasing factors present in the bullfrog hypothalamus.

[1] R J Denver,et al. Evolution of the Corticotropin‐releasing Hormone Signaling System and Its Role in Stress‐induced Phenotypic Plasticity , 1999, Annals of the New York Academy of Sciences.

[2] G. Hendricks,et al. Effects of corticotropin releasing factor on the production of adrenocorticotropic hormone by leukocyte populations. , 1998, British poultry science.

[3] H. Vaudry,et al. CRF, urotensin I, and sauvagine stimulate the release of POMC-derived peptides from goldfish neurointermediate lobe cells. , 1990, General and comparative endocrinology.

[4] N. Ling,et al. Comparative effects of corticotropin-releasing factor, arginine vasopressin, and related neuropeptides on the secretion of ACTH and alpha-MSH by frog anterior pituitary cells and neurointermediate lobes in vitro. , 1986, General and comparative endocrinology.

[5] N. Ling,et al. Immunohistochemical localization and radioimmunoassay of corticotropin-releasing factor in the forebrain and hypophysis of the frog Rana ridibunda. , 1985, Neuroendocrinology.

[6] W. Vale,et al. Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin. , 1982, Science.

[7] S. Kikuyama,et al. Development of radioimmunoassay for bullfrog thyroid-stimulating hormone (TSH): effects of hypothalamic releasing hormones on the release of TSH from the pituitary in vitro. , 2004, General and comparative endocrinology.